Schema for knownGenePep
  Database: hg38    Primary Table: knownGenePep    Row Count: 120,401   Data last updated: 2022-05-15
Format description: A predicted peptide - linked to a predicted gene.
fieldexampleSQL type info description
name ENST00000641515.2varchar(255) values Name of gene - same as in genePred
seq MKKVTAEAISWNESTSETNNSMVTEFI...longblob   Peptide sequence

Connected Tables and Joining Fields
        hg38.bioCycPathway.kgID (via knownGenePep.name)
      hg38.ccdsKgMap.geneId (via knownGenePep.name)
      hg38.ceBlastTab.query (via knownGenePep.name)
      hg38.dmBlastTab.query (via knownGenePep.name)
      hg38.drBlastTab.query (via knownGenePep.name)
      hg38.foldUtr3.name (via knownGenePep.name)
      hg38.foldUtr5.name (via knownGenePep.name)
      hg38.gnfAtlas2Distance.query (via knownGenePep.name)
      hg38.gnfAtlas2Distance.target (via knownGenePep.name)
      hg38.gnfU95Distance.query (via knownGenePep.name)
      hg38.gnfU95Distance.target (via knownGenePep.name)
      hg38.humanHprdP2P.query (via knownGenePep.name)
      hg38.humanHprdP2P.target (via knownGenePep.name)
      hg38.humanVidalP2P.query (via knownGenePep.name)
      hg38.humanVidalP2P.target (via knownGenePep.name)
      hg38.humanWankerP2P.query (via knownGenePep.name)
      hg38.humanWankerP2P.target (via knownGenePep.name)
      hg38.keggPathway.kgID (via knownGenePep.name)
      hg38.kgAlias.kgID (via knownGenePep.name)
      hg38.kgColor.kgID (via knownGenePep.name)
      hg38.kgProtAlias.kgID (via knownGenePep.name)
      hg38.kgSpAlias.kgID (via knownGenePep.name)
      hg38.kgTargetAli.qName (via knownGenePep.name)
      hg38.kgXref.kgID (via knownGenePep.name)
      hg38.knownAttrs.kgID (via knownGenePep.name)
      hg38.knownBlastTab.query (via knownGenePep.name)
      hg38.knownBlastTab.target (via knownGenePep.name)
      hg38.knownCanonical.transcript (via knownGenePep.name)
      hg38.knownCds.name (via knownGenePep.name)
      hg38.knownGene.name (via knownGenePep.name)
      hg38.knownGeneMrna.name (via knownGenePep.name)
      hg38.knownIsoforms.transcript (via knownGenePep.name)
      hg38.knownToEnsembl.name (via knownGenePep.name)
      hg38.knownToGnfAtlas2.name (via knownGenePep.name)
      hg38.knownToHprd.name (via knownGenePep.name)
      hg38.knownToKeggEntrez.name (via knownGenePep.name)
      hg38.knownToLocusLink.name (via knownGenePep.name)
      hg38.knownToLynx.name (via knownGenePep.name)
      hg38.knownToMrna.name (via knownGenePep.name)
      hg38.knownToMrnaSingle.name (via knownGenePep.name)
      hg38.knownToMupit.name (via knownGenePep.name)
      hg38.knownToNextProt.name (via knownGenePep.name)
      hg38.knownToPfam.name (via knownGenePep.name)
      hg38.knownToRefSeq.name (via knownGenePep.name)
      hg38.knownToSuper.gene (via knownGenePep.name)
      hg38.knownToTag.name (via knownGenePep.name)
      hg38.knownToU133.name (via knownGenePep.name)
      hg38.knownToU95.name (via knownGenePep.name)
      hg38.knownToVisiGene.name (via knownGenePep.name)
      hg38.knownToWikipedia.name (via knownGenePep.name)
      hg38.mmBlastTab.query (via knownGenePep.name)
      hg38.rnBlastTab.query (via knownGenePep.name)
      hg38.scBlastTab.query (via knownGenePep.name)
      hg38.ucscScop.ucscId (via knownGenePep.name)

Sample Rows
 
nameseq
ENST00000641515.2MKKVTAEAISWNESTSETNNSMVTEFIFLGLSDSQELQTFLFMLFFVFYGGIVFGNLLIVITVVSDSHLHSPMYFLLANLSLIDLSLSSVTAPKMITDFFSQRKVISFKGCLVQIFLLHFFGGSEMVI ...
ENST00000426406.4MDGENHSVVSEFLFLGLTHSWEIQLLLLVFSSVLYVASITGNILIVFSVTTDPHLHSPMYFLLASLSFIDLGACSVTSPKMIYDLFRKRKVISFGGCIAQIFFIHVVGGVEMVLLIAMAFDRYVALCK ...
ENST00000332831.5MDGENHSVVSEFLFLGLTHSWEIQLLLLVFSSVLYVASITGNILIVFSVTTDPHLHSPMYFLLASLSFIDLGACSVTSPKMIYDLFRKRKVISFGGCIAQIFFIHVVGGVEMVLLIAMAFDRYVALCK ...
ENST00000616016.5MPAVKKEFPGREDLALALATFHPTLAALPLPPLPGYLAPLPAAAALPPAASLPASAAGYEALLAPPLRPPRAYLSLHEAAPHLHLPRDPLALERFSATAAAAPDFQPLLDNGEPCIEVECGANRALLY ...
ENST00000618323.5MPAVKKEFPGREDLALALATFHPTLAALPLPPLPGYLAPLPAAAALPPAASLPASAAGYEALLAPPLRPPRAYLSLHEAAPHLHLPRDPLALERFSATAAAAPDFQPLLDNGEPCIEVECGANRALLY ...
ENST00000437963.5MSKGILQVHPPICDCPGCRISSPVNRGRLADKRTVALPAARNLKKERTPSFSASDGDSDGSGPTCGRRPGLKQEDGPHIRIMKRRVHTHWDVNISFREASCSQDGNLPT
ENST00000342066.8MSKGILQVHPPICDCPGCRISSPVNRGRLADKRTVALPAARNLKKERTPSFSASDGDSDGSGPTCGRRPGLKQEDGPHIRIMKRRVHTHWDVNISFREASCSQDGNLPTLISSVHRSRHLVMPEHQSR ...
ENST00000616125.5MSKGILQVHPPICDCPGCRISSPVNRGRLADKRTVALPAARNLKKERTPSFSASDGDSDGSGPTCGRRPGLKQEDGPHIRIMKRRVHTHWDVNISFREASCSQDGNLPTLISSVHRSRHLVMPEHQSR ...
ENST00000617307.5MSKGILQVHPPICDCPGCRISSPVNRGRLADKRTVALPAARNLKKERTPSFSASDGDSDGSGPTCGRRPGLKQEDGPHIRIMKRRVHTHWDVNISFREASCSQDGNLPTLISSVHRSRHLVMPEHQSR ...
ENST00000618181.5MSKGILQVHPPICDCPGCRISSPVNRGRLADKRTVALPAARNLKKERTPSFSASDGDSDGSGPTCGRRPGLKQEDGPHIRIMKRSQDGNLPTLISSVHRSRHLVMPEHQSRCEFQRGSLEIGLRPAGD ...

Note: all start coordinates in our database are 0-based, not 1-based. See explanation here.